N-Cadherin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0433P
Artikelname: N-Cadherin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0433P
Hersteller Artikelnummer: CNA0433P
Alternativnummer: MBL-CNA0433P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human N-Cadherin (NP_001783.2).
Konjugation: Unconjugated
Alternative Synonym: CDHN, NCAD, ACOGS, ADHD8, CD325, ARVD14, CDw325
Klonalität: Polyclonal
Molekulargewicht: 100kDa
NCBI: 1000
UniProt: P19022
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: IDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVN
Target-Kategorie: CDH2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200