CARS Rabbit mAb, Clone: [ARC2504], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0438S
Artikelname: CARS Rabbit mAb, Clone: [ARC2504], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0438S
Hersteller Artikelnummer: CNA0438S
Alternativnummer: MBL-CNA0438S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 650-748 of human CARS (P49589).
Konjugation: Unconjugated
Alternative Synonym: CARS, MDBH, CYSRS, MCDDBH, MGC:11246
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2504]
Molekulargewicht: 85kDa
NCBI: 833
UniProt: P49589
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ
Target-Kategorie: CARS1
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200