Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0461T
Artikelname: Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0461T
Hersteller Artikelnummer: CNA0461T
Alternativnummer: MBL-CNA0461T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2221-2511 of human Fatty Acid Synthase (FASN) (NP_004095.4).
Konjugation: Unconjugated
Alternative Synonym: FAS, OA-519, SDR27X1
Klonalität: Polyclonal
Molekulargewicht: 273kDa
NCBI: 2194
UniProt: P49327
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSV
Target-Kategorie: FASN
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100