Chk2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0466S
Artikelname: Chk2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0466S
Hersteller Artikelnummer: CNA0466S
Alternativnummer: MBL-CNA0466S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human Chk2 (NP_009125.1).
Konjugation: Unconjugated
Alternative Synonym: CDS1, CHK2, LFS2, RAD53, hCds1, HuCds1, PP1425
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 11200
UniProt: O96017
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEY
Target-Kategorie: CHEK2
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50