TSC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0492P
Artikelname: TSC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0492P
Hersteller Artikelnummer: CNA0492P
Alternativnummer: MBL-CNA0492P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1255 of human TSC2 (NP_000539.2).
Konjugation: Unconjugated
Alternative Synonym: LAM, TSC4, PPP1R160
Klonalität: Polyclonal
Molekulargewicht: 201kDa
NCBI: 7249
UniProt: P49815
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: TAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSV
Target-Kategorie: TSC2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200