N-Myc/MYCN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0499S
Artikelname: N-Myc/MYCN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0499S
Hersteller Artikelnummer: CNA0499S
Alternativnummer: MBL-CNA0499S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human N-Myc/MYCN (NP_005369.2).
Konjugation: Unconjugated
Alternative Synonym: NMYC, ODED, MODED, N-myc, bHLHe37, MYCNsORF, MYCNsPEP
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 4613
UniProt: P04198
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED
Target-Kategorie: MYCN
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200