CRKL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0511S
Artikelname: CRKL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0511S
Hersteller Artikelnummer: CNA0511S
Alternativnummer: MBL-CNA0511S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CRKL (P46109).
Konjugation: Unconjugated
Alternative Synonym: CRKL
Klonalität: Polyclonal
Molekulargewicht: 34kDa
Sensitivitaet: 1 mg/mL
NCBI: 1399
UniProt: P46109
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Target-Kategorie: CRKL
Application Verdünnung: WB: WB,1:500 - 1:2000