Timeless Rabbit mAb, Clone: [ARC1827], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0512S
Artikelname: Timeless Rabbit mAb, Clone: [ARC1827], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0512S
Hersteller Artikelnummer: CNA0512S
Alternativnummer: MBL-CNA0512S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1058-1208 of human Timeless (Q9UNS1).
Konjugation: Unconjugated
Alternative Synonym: TIM, TIM1, hTIM, FASPS4
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1827]
Molekulargewicht: 139kDa
NCBI: 8914
UniProt: Q9UNS1
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDEDD
Target-Kategorie: TIMELESS
Application Verdünnung: WB: WB,1:500 - 1:1000