IRF4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0524T
Artikelname: IRF4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0524T
Hersteller Artikelnummer: CNA0524T
Alternativnummer: MBL-CNA0524T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-350 of human IRF4 (NP_002451.2).
Konjugation: Unconjugated
Alternative Synonym: MUM1, LSIRF, SHEP8, NF-EM5
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 3662
UniProt: Q15306
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL
Target-Kategorie: IRF4
Application Verdünnung: WB: WB,1:500 - 1:1000