[KO Validated] HK1 Rabbit mAb, Clone: [ARC0256], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0533S
Artikelname: [KO Validated] HK1 Rabbit mAb, Clone: [ARC0256], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0533S
Hersteller Artikelnummer: CNA0533S
Alternativnummer: MBL-CNA0533S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367).
Konjugation: Unconjugated
Alternative Synonym: HK, HKD, HKI, HXK1, NMSR, RP79, HMSNR, HK1-ta, HK1-tb, HK1-tc, NEDVIBA, hexokinase
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0256]
Molekulargewicht: 102kDa
Sensitivitaet: 0.647 mg/mL
NCBI: 3098
UniProt: P19367
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV
Target-Kategorie: HK1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000