GTF2F2 Rabbit mAb, Clone: [ARC2513], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0536S
Artikelname: GTF2F2 Rabbit mAb, Clone: [ARC2513], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0536S
Hersteller Artikelnummer: CNA0536S
Alternativnummer: MBL-CNA0536S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF2F2 (P13984).
Konjugation: Unconjugated
Alternative Synonym: BTF4, RAP30, TF2F2, TFIIF
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2513]
Molekulargewicht: 28kDa
NCBI: 2963
UniProt: P13984
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
Target-Kategorie: GTF2F2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200