RALA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0541S
Artikelname: RALA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0541S
Hersteller Artikelnummer: CNA0541S
Alternativnummer: MBL-CNA0541S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human RALA (NP_005393.2).
Konjugation: Unconjugated
Alternative Synonym: RAL, HINCONS
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 5898
UniProt: P11233
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
Target-Kategorie: RALA
Application Verdünnung: WB: WB,1:500 - 1:2000