NEDD4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0552S
Artikelname: NEDD4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0552S
Hersteller Artikelnummer: CNA0552S
Alternativnummer: MBL-CNA0552S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-460 of human NEDD4 (NP_940682.2).
Konjugation: Unconjugated
Alternative Synonym: RPF1, NEDD4-1
Klonalität: Polyclonal
Molekulargewicht: 149kDa
NCBI: 4734
UniProt: P46934
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYI
Target-Kategorie: NEDD4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200