NOTCH2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0560S
Artikelname: NOTCH2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0560S
Hersteller Artikelnummer: CNA0560S
Alternativnummer: MBL-CNA0560S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2242-2471 of human NOTCH2 (NP_077719.2).
Konjugation: Unconjugated
Alternative Synonym: hN2, AGS2, HJCYS
Klonalität: Polyclonal
Molekulargewicht: 265kDa
NCBI: 4853
UniProt: Q04721
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHNNMQVYA
Target-Kategorie: NOTCH2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200