PGD Rabbit mAb, Clone: [ARC2516], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0563S
Artikelname: PGD Rabbit mAb, Clone: [ARC2516], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0563S
Hersteller Artikelnummer: CNA0563S
Alternativnummer: MBL-CNA0563S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 384-483 of human PGD (P52209).
Konjugation: Unconjugated
Alternative Synonym: 6PGD
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2516]
Molekulargewicht: 53kDa
NCBI: 5226
UniProt: P52209
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Target-Kategorie: PGD
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000