GBP1 Rabbit mAb, Clone: [ARC2521], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0570S
Artikelname: GBP1 Rabbit mAb, Clone: [ARC2521], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0570S
Hersteller Artikelnummer: CNA0570S
Alternativnummer: MBL-CNA0570S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455).
Konjugation: Unconjugated
Alternative Synonym: GBP1, guanylate-binding protein 1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2521]
Molekulargewicht: 68kDa
NCBI: 2633
UniProt: P32455
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
Target-Kategorie: GBP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200