Pumilio 1 Rabbit mAb, Clone: [ARC1830], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0571S
Artikelname: Pumilio 1 Rabbit mAb, Clone: [ARC1830], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0571S
Hersteller Artikelnummer: CNA0571S
Alternativnummer: MBL-CNA0571S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human Pumilio 1 (Q14671).
Konjugation: Unconjugated
Alternative Synonym: PUMH, HSPUM, PUMH1, PUML1, SCA47
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1830]
Molekulargewicht: 126kDa
NCBI: 9698
UniProt: Q14671
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSE
Target-Kategorie: PUM1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200