PEBP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0578S
Artikelname: PEBP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0578S
Hersteller Artikelnummer: CNA0578S
Alternativnummer: MBL-CNA0578S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human PEBP1 (NP_002558.1).
Konjugation: Unconjugated
Alternative Synonym: PBP, HCNP, PEBP, RKIP, HCNPpp, PEBP-1, HEL-210, HEL-S-34, HEL-S-96
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 5037
UniProt: P30086
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Target-Kategorie: PEBP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50