Smad6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0579S
Artikelname: Smad6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0579S
Hersteller Artikelnummer: CNA0579S
Alternativnummer: MBL-CNA0579S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 257-496 of human Smad6 (NP_005576.3).
Konjugation: Unconjugated
Alternative Synonym: AOVD2, MADH6, MADH7, HsT17432
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 4091
UniProt: O43541
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR
Target-Kategorie: SMAD6
Application Verdünnung: WB: WB,1:500 - 1:1000