PIST/GOPC Rabbit mAb, Clone: [ARC1831], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0582S
Artikelname: PIST/GOPC Rabbit mAb, Clone: [ARC1831], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0582S
Hersteller Artikelnummer: CNA0582S
Alternativnummer: MBL-CNA0582S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIST/GOPC (Q9HD26).
Konjugation: Unconjugated
Alternative Synonym: CAL, FIG, PIST, GOPC1, dJ94G16.2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1831]
Molekulargewicht: 51kDa
NCBI: 57120
UniProt: Q9HD26
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD
Target-Kategorie: GOPC
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200