PPP1R12A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0587T
Artikelname: PPP1R12A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0587T
Hersteller Artikelnummer: CNA0587T
Alternativnummer: MBL-CNA0587T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PPP1R12A (NP_002471.1).
Konjugation: Unconjugated
Alternative Synonym: MBS, GUBS, M130, MYPT1
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 4659
UniProt: O14974
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG
Target-Kategorie: PPP1R12A
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100