LAMP2 Rabbit mAb, Clone: [ARC0274], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0593S
Artikelname: LAMP2 Rabbit mAb, Clone: [ARC0274], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0593S
Hersteller Artikelnummer: CNA0593S
Alternativnummer: MBL-CNA0593S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 311-410 of human LAMP2 (P13473).
Konjugation: Unconjugated
Alternative Synonym: DND, LAMPB, CD107b, LAMP-2, LGP-96, LGP110
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0274]
Molekulargewicht: 45kDa
NCBI: 3920
UniProt: P13473
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
Target-Kategorie: LAMP2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000