TJP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0594S
Artikelname: TJP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0594S
Hersteller Artikelnummer: CNA0594S
Alternativnummer: MBL-CNA0594S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 951-1190 of human TJP2 (NP_004808.2).
Konjugation: Unconjugated
Alternative Synonym: ZO2, X104, FHCA1, PFIC4, DFNA51, DUP9q21.11, C9DUPq21.11
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 9414
UniProt: Q9UDY2
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL
Target-Kategorie: TJP2
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000