DYRK1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0595S
Artikelname: DYRK1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0595S
Hersteller Artikelnummer: CNA0595S
Alternativnummer: MBL-CNA0595S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2).
Konjugation: Unconjugated
Alternative Synonym: MNB, DYRK, HP86, MNBH, MRD7, DYRK1
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 1859
UniProt: Q13627
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Target-Kategorie: DYRK1A
Application Verdünnung: WB: WB,1:500 - 1:1000