NCS1 Rabbit mAb, Clone: [ARC2523], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0598S
Artikelname: NCS1 Rabbit mAb, Clone: [ARC2523], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0598S
Hersteller Artikelnummer: CNA0598S
Alternativnummer: MBL-CNA0598S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 91-190 of human NCS1 (P62166).
Konjugation: Unconjugated
Alternative Synonym: FLUP, FREQ
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2523]
Molekulargewicht: 22kDa
NCBI: 23413
UniProt: P62166
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Target-Kategorie: NCS1
Application Verdünnung: WB: WB,1:500 - 1:1000