Olig3 Rabbit mAb, Clone: [ARC2524], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0600S
Artikelname: Olig3 Rabbit mAb, Clone: [ARC2524], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0600S
Hersteller Artikelnummer: CNA0600S
Alternativnummer: MBL-CNA0600S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 173-272 of human Olig3 (Q7RTU3).
Konjugation: Unconjugated
Alternative Synonym: Bhlhb7, bHLHe20
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2524]
Molekulargewicht: 29kDa
NCBI: 167826
UniProt: Q7RTU3
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: HAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK
Target-Kategorie: OLIG3
Application Verdünnung: WB: WB,1:500 - 1:1000