NUDT5 Rabbit mAb, Clone: [ARC2525], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0609S
Artikelname: NUDT5 Rabbit mAb, Clone: [ARC2525], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0609S
Hersteller Artikelnummer: CNA0609S
Alternativnummer: MBL-CNA0609S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDT5 (Q9UKK9).
Konjugation: Unconjugated
Alternative Synonym: YSA1, YSA1H, YSAH1, hNUDT5
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2525]
Molekulargewicht: 24kDa
NCBI: 11164
UniProt: Q9UKK9
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLID
Target-Kategorie: NUDT5
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200