INCENP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0622S
Artikelname: INCENP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0622S
Hersteller Artikelnummer: CNA0622S
Alternativnummer: MBL-CNA0622S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 785-914 of human INCENP (NP_064623.2).
Konjugation: Unconjugated
Alternative Synonym: INCENP
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 3619
UniProt: Q9NQS7
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH
Target-Kategorie: INCENP
Application Verdünnung: WB: WB,1:500 - 1:2000