CRMP3/DPYSL4 Rabbit mAb, Clone: [ARC2530], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0624S
Artikelname: CRMP3/DPYSL4 Rabbit mAb, Clone: [ARC2530], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0624S
Hersteller Artikelnummer: CNA0624S
Alternativnummer: MBL-CNA0624S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CRMP3/DPYSL4 (O14531).
Konjugation: Unconjugated
Alternative Synonym: CRMP3, DRP-4, ULIP4
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2530]
Molekulargewicht: 62kDa
NCBI: 10570
UniProt: O14531
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGG
Target-Kategorie: DPYSL4
Application Verdünnung: WB: WB,1:2000 - 1:6000