TCL1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0629S
Artikelname: TCL1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0629S
Hersteller Artikelnummer: CNA0629S
Alternativnummer: MBL-CNA0629S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human TCL1A (NP_001092195.1).
Konjugation: Unconjugated
Alternative Synonym: TCL1
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 8115
UniProt: P56279
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Target-Kategorie: TCL1A
Application Verdünnung: WB: WB,1:500 - 1:2000