LRP1 Rabbit mAb, Clone: [ARC0275], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0633S
Artikelname: LRP1 Rabbit mAb, Clone: [ARC0275], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0633S
Hersteller Artikelnummer: CNA0633S
Alternativnummer: MBL-CNA0633S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 4400-4500 of human LRP1 (Q07954).
Konjugation: Unconjugated
Alternative Synonym: APR, KPA, LRP, A2MR, CD91, APOER, LRP1A, TGFBR5, IGFBP3R, IGFBP-3R, IGFBP3R1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0275]
Molekulargewicht: 505kDa
NCBI: 4035
UniProt: Q07954
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGVVFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
Target-Kategorie: LRP1
Application Verdünnung: WB: WB,1:500 - 1:2000