Lysozyme (LYZ) Rabbit mAb, Clone: [ARC0276], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0641S
Artikelname: Lysozyme (LYZ) Rabbit mAb, Clone: [ARC0276], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0641S
Hersteller Artikelnummer: CNA0641S
Alternativnummer: MBL-CNA0641S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (P61626).
Konjugation: Unconjugated
Alternative Synonym: LZM, LYZF1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0276]
Molekulargewicht: 17kDa
NCBI: 4069
UniProt: P61626
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Target-Kategorie: LYZ
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200