Histone H1.2 Rabbit mAb, Clone: [ARC1836], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0646S
Artikelname: Histone H1.2 Rabbit mAb, Clone: [ARC1836], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0646S
Hersteller Artikelnummer: CNA0646S
Alternativnummer: MBL-CNA0646S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.2 (P16403).
Konjugation: Unconjugated
Alternative Synonym: H1C,H1.2,H1F2,H1s-1,HIST1H1C
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1836]
Molekulargewicht: 21kDa
NCBI: 3006
UniProt: P16403
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG
Target-Kategorie: H1-2
Application Verdünnung: WB: WB,1:1000 -1:5000|IF/ICC,1:50 - 1:500