CSK Rabbit mAb, Clone: [ARC1835], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0666S
Artikelname: CSK Rabbit mAb, Clone: [ARC1835], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0666S
Hersteller Artikelnummer: CNA0666S
Alternativnummer: MBL-CNA0666S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSK (P41240).
Konjugation: Unconjugated
Alternative Synonym: CSK, tyrosine-protein kinase CSK
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1835]
Molekulargewicht: 51kDa
NCBI: 1445
UniProt: P41240
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
Target-Kategorie: CSK
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200