GATA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0677S
Artikelname: GATA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0677S
Hersteller Artikelnummer: CNA0677S
Alternativnummer: MBL-CNA0677S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GATA2 (NP_116027.2).
Konjugation: Unconjugated
Alternative Synonym: DCML, IMD21, NFE1B, MONOMAC
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 2624
UniProt: P23769
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVP
Target-Kategorie: GATA2
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200