ACVR1C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0678P
Artikelname: ACVR1C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0678P
Hersteller Artikelnummer: CNA0678P
Alternativnummer: MBL-CNA0678P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2).
Konjugation: Unconjugated
Alternative Synonym: ALK7, ACVRLK7
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 130399
UniProt: Q8NER5
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Target-Kategorie: ACVR1C
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200