Endothelin 1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0686P
Artikelname: Endothelin 1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0686P
Hersteller Artikelnummer: CNA0686P
Alternativnummer: MBL-CNA0686P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-212 of human Endothelin 1 (NP_001946.3).
Konjugation: Unconjugated
Alternative Synonym: ET1, QME, PPET1, ARCND3, HDLCQ7
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 1906
UniProt: P05305
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: APETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
Target-Kategorie: EDN1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200