IL17A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA0688P
| Artikelname: |
IL17A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA0688P |
| Hersteller Artikelnummer: |
CNA0688P |
| Alternativnummer: |
MBL-CNA0688P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-155 of human IL17A (NP_002181.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
IL17, CTLA8, IL-17, ILA17, CTLA-8, IL-17A |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
18kDa |
| NCBI: |
3605 |
| UniProt: |
Q16552 |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Target-Kategorie: |
IL17A |
| Application Verdünnung: |
WB: WB,1:100 - 1:500|IF,1:50 - 1:200 |
