MGMT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0693P
Artikelname: MGMT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0693P
Hersteller Artikelnummer: CNA0693P
Alternativnummer: MBL-CNA0693P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human MGMT (NP_002403.2).
Konjugation: Unconjugated
Alternative Synonym: MGMT
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 4255
UniProt: P16455
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVV
Target-Kategorie: MGMT
Application Verdünnung: WB: WB,1:500 - 1:1000