MMP7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0695T
Artikelname: MMP7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0695T
Hersteller Artikelnummer: CNA0695T
Alternativnummer: MBL-CNA0695T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MMP7 (NP_002414.1).
Konjugation: Unconjugated
Alternative Synonym: MMP-7, MPSL1, PUMP-1
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 4316
UniProt: P09237
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG
Target-Kategorie: MMP7
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500