Integrin alpha 4 (ITGA4/CD49d) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0696S
Artikelname: Integrin alpha 4 (ITGA4/CD49d) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0696S
Hersteller Artikelnummer: CNA0696S
Alternativnummer: MBL-CNA0696S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 770-970 of human Integrin alpha 4 (ITGA4/CD49d) (NP_000876.3).
Konjugation: Unconjugated
Alternative Synonym: IA4, CD49D
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 3676
UniProt: P13612
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LKYEVKLTVHGFVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLFNILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQ
Target-Kategorie: ITGA4
Application Verdünnung: WB: WB,1:500 - 1:1000