Desmin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0699P
Artikelname: Desmin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0699P
Hersteller Artikelnummer: CNA0699P
Alternativnummer: MBL-CNA0699P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-470 of human Desmin (NP_001918.3).
Konjugation: Unconjugated
Alternative Synonym: CSM1, CSM2, CDCD3, LGMD1D, LGMD1E, LGMD2R
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 1674
UniProt: P17661
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: DFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTND
Target-Kategorie: DES
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200