HBG1/2 Rabbit mAb, Clone: [ARC1838], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0704S
Artikelname: HBG1/2 Rabbit mAb, Clone: [ARC1838], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0704S
Hersteller Artikelnummer: CNA0704S
Alternativnummer: MBL-CNA0704S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG1 (P69891).
Konjugation: Unconjugated
Alternative Synonym: HBG-T2, HBGA, HBGR, HSGGL1, PRO2979
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1838]
Molekulargewicht: 12kDa
NCBI: 3047
UniProt: P69891
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVD
Target-Kategorie: HBG1/2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200