IKKbeta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0714T
Artikelname: IKKbeta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0714T
Hersteller Artikelnummer: CNA0714T
Alternativnummer: MBL-CNA0714T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-669 of IKKbeta (NP_001547.1).
Konjugation: Unconjugated
Alternative Synonym: IKK2, IKKB, IMD15, IMD15A, IMD15B, NFKBIKB, IKK-beta
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 3551
UniProt: O14920
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKE
Target-Kategorie: IKBKB
Application Verdünnung: WB: WB,1:500 - 1:2000