TSC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0720S
Artikelname: TSC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0720S
Hersteller Artikelnummer: CNA0720S
Alternativnummer: MBL-CNA0720S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TSC1 (NP_000359.1).
Konjugation: Unconjugated
Alternative Synonym: LAM, TSC
Klonalität: Polyclonal
Molekulargewicht: 130kDa
NCBI: 7248
UniProt: Q92574
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QAFTPIDLPCGSADESPAGDRECQTSLETSIFTPSPCKIPPPTRVGFGSGQPPPYDHLFEVALPKTAHHFVIRKTEELLKKAKGNTEEDGVPSTSPMEVLD
Target-Kategorie: TSC1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100