MAGE-1/MAGE1A Rabbit mAb, Clone: [ARC1839], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0723S
Artikelname: MAGE-1/MAGE1A Rabbit mAb, Clone: [ARC1839], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0723S
Hersteller Artikelnummer: CNA0723S
Alternativnummer: MBL-CNA0723S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-309 of human MAGE-1/MAGE1A (P43355).
Konjugation: Unconjugated
Alternative Synonym: CT1.1, MAGE1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1839]
Molekulargewicht: 34kDa
NCBI: 4100
UniProt: P43355
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV
Target-Kategorie: MAGEA1
Application Verdünnung: WB: WB,1:500 - 1:1000