SUOX Rabbit mAb, Clone: [ARC2535], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0733S
Artikelname: SUOX Rabbit mAb, Clone: [ARC2535], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0733S
Hersteller Artikelnummer: CNA0733S
Alternativnummer: MBL-CNA0733S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUOX (P51687).
Konjugation: Unconjugated
Alternative Synonym: SUOX, sulfite oxidase
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2535]
Molekulargewicht: 60kDa
NCBI: 6821
UniProt: P51687
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: IWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPP
Target-Kategorie: SUOX
Application Verdünnung: WB: WB,1:500 - 1:1000