STAT6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0755P
Artikelname: STAT6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0755P
Hersteller Artikelnummer: CNA0755P
Alternativnummer: MBL-CNA0755P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human STAT6 (NP_003144.3).
Konjugation: Unconjugated
Alternative Synonym: STAT6B, STAT6C, D12S1644, IL-4-STAT
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 6778
UniProt: P42226
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTV
Target-Kategorie: STAT6
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200