ALK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0766T
Artikelname: ALK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0766T
Hersteller Artikelnummer: CNA0766T
Alternativnummer: MBL-CNA0766T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1550-1620 of human ALK (NP_004295.2).
Konjugation: Unconjugated
Alternative Synonym: ALK1, CD246, NBLST3
Klonalität: Polyclonal
Molekulargewicht: 176kDa
NCBI: 238
UniProt: Q9UM73
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
Target-Kategorie: ALK
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:100