hnRNP K Rabbit mAb, Clone: [ARC0512], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0772S
Artikelname: hnRNP K Rabbit mAb, Clone: [ARC0512], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0772S
Hersteller Artikelnummer: CNA0772S
Alternativnummer: MBL-CNA0772S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978).
Konjugation: Unconjugated
Alternative Synonym: AUKS, CSBP, TUNP, HNRPK
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0512]
Molekulargewicht: 49kDa/51kDa
Sensitivitaet: 0.75 mg/mL
NCBI: 3190
UniProt: P61978
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
Target-Kategorie: HNRNPK
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200